Welcome to Support Tech
France Language
Allemagne AllemagneDéfaut Défaut
EUR Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Catégories
Pannier
0
Product Details
AMD Ryzen 5 3400G
AMD Ryzen 5 3400G
AMD Ryzen 5 3400G

AMD Ryzen 5 3400G

Product Code: rjT3gf6
Product Condition: Nouveau
139,99 € Taxes incluses
 Add to Cart
Description
Le processeur AMD Ryzen 5 3400G offre une base solide pour monter une configuration multimedia et même gaming orientée jeux esport ! Radeon Vega 11 pour les performances graphiques, architecture Zen+ gravée en 12 nm pour les applications : AMD propose à nouveau un processeur à l'excellent rapport qualité prix !
Product Added to your Cart
x

-------- ou --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i